PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0016s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SBP
Protein Properties Length: 1049aa    MW: 116105 Da    PI: 8.095
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0016s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.5e-41120197178
                             --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                     SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                             +Cqv++C++dl++ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  SapurV1A.0016s0070.1.p 120 MCQVDNCKEDLTKAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 197
                             6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.3E-34115182IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.966118195IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-37119199IPR004333Transcription factor, SBP-box
PfamPF031101.2E-29121194IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1049 aa     Download sequence    Send to blast
MTSMAKKHDL SYQTPNSQLL PQFLQTSRGK NWNPKAWDWD SVGFVAKPSV AAETLRLGTV  60
SREPKKKDEN DSKNKSNSAN EDDDGLGLNL GGSLTSVEEP VSRTNKRVRS GSPGNGSYPM  120
CQVDNCKEDL TKAKDYHRRH KVCEVHSKAT KALVGKQMQR FCQQCSRFHP LSEFDEGKRS  180
CRRRLAGHNR RRRKTQPEDV TSQLLLPGSR DMNNNGNLDI VNLLTALAHS QGRNDDKSTN  240
CPTVPDKDQL IQILYKINSL PLPMDLAAKL SNIASLNGKN PNQPSLGHQN RLNGTVSSPS  300
TTDLLAVLST TLAASAPDAQ AILSQRSSHS SDSEKSKLTG PNQVTGPHLQ KRSNVEFPSV  360
GSERLSRCYE SPVEDSDCQI QESHPNLPLQ LFSSSPENES RQKPASSMKY FSSDSSNPIE  420
DRSPSSSPPV VQKLFPLQST AETMKSEKMP VRREVNANVE GGRSHGGALP LELFRGLNRE  480
PDHGSFQSFP YQGGYTSSSG SDHSPSSQNS DSQDRTGRII FKLFDKDPSH FPGTLRTKIY  540
NWLSNSPSEM ESYIRPGCVV LSVYLSMPSP SWEQLERNLL QLVDSLVQDS DSDLWRSGRF  600
LLNTGRQLAS QKDGRVRLCK SWRTWSSPEL ILVSPVAVIG GQETSLQLKG RNLTGPGTKI  660
HCTYMGGYTS KEVTDSSSPG SMYDEINVGG FKIHGPSPSI LGRCFIEVEN GFKGNSFPVI  720
IADASICKEL RLLESEFDEK AEASNIVSEE QAHDLGRPRS REEALHFLNE LGWLFQRKSV  780
PSMLEAPDYS LNRFKFLLIF SVERDYCVLV KTILDMLVER NMCRDELSKE SLEMLHEIQL  840
LNRSVKRRCR EMADLLIHYS IIGLDNSSRT YIFPPNVGGP GGITPLHLAA CASGSDGLVD  900
ALTNDPQEIG LSCWNSVLDA NGQSPYAYAF MTKNHSCNLL VARKLSDKRN GQISVAIGNE  960
IEQVAMEQEQ RTMSQFQRES KSCAKCASVA AKFHGRFPGS RGLLQRPYIH SMLAIAAVCV  1020
CVCLFFRGAP DIGLVAPFKW ENLDYGTI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-32111194184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00664PBMTransfer from Potri.002G002400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0016s0070.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024450222.10.0squamosa promoter-binding-like protein 14 isoform X1
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2K2BB790.0A0A2K2BB79_POPTR; Uncharacterized protein
STRINGPOPTR_0002s00440.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]