PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0012s0820.13.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family VOZ
Protein Properties Length: 464aa    MW: 51724.2 Da    PI: 5.2252
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0012s0820.13.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ434.61.4e-1331813981217
                      VOZ   1 pppsaflgpkcalwdctrpaqg.sewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaat 85 
                              pppsaflgpkcalwdc+rpaqg  ew+qdycssfh +lalneg+pg++pvlrp+gi+lkdgllfaalsak++ k+vgipecegaat
  SapurV1A.0012s0820.13.p 181 PPPSAFLGPKCALWDCPRPAQGgLEWCQDYCSSFHHSLALNEGPPGMSPVLRPGGIGLKDGLLFAALSAKAEEKDVGIPECEGAAT 266
                              89******************9648************************************************************** PP

                      VOZ  86 akspwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlye 171
                              akspwna+elfdl +legetirewlffdkprrafesgnrkqrslpdy+grgwhesrkqvm+efgglkrsyymdpqp+++fewhlye
  SapurV1A.0012s0820.13.p 267 AKSPWNAPELFDLFVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYTGRGWHESRKQVMNEFGGLKRSYYMDPQPLNNFEWHLYE 352
                              ************************************************************************************** PP

                      VOZ 172 yeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                              yei+++da+alyrlelk vd+kksakgk++++s+adlqk++grlta
  SapurV1A.0012s0820.13.p 353 YEISKCDACALYRLELKAVDGKKSAKGKIANESVADLQKQMGRLTA 398
                              ********************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MWLSSKSKFI RCFVNGNPSS MSPLQHLLCN KLGLKFLSHF EYMYIPTYHG GSLGSFSTDI  60
CRLLQLCEEE DDATSALAAP KLEPNDQSMQ AGDKVVFQEA YAVNHGQQEH AFPFVDQCKD  120
SPTGVRSLAI SNIEGAAQLD YHQFDLPQTF EQNFYTDFNG TDLGEEDGMP HVSSYLPSMC  180
PPPSAFLGPK CALWDCPRPA QGGLEWCQDY CSSFHHSLAL NEGPPGMSPV LRPGGIGLKD  240
GLLFAALSAK AEEKDVGIPE CEGAATAKSP WNAPELFDLF VLEGETIREW LFFDKPRRAF  300
ESGNRKQRSL PDYTGRGWHE SRKQVMNEFG GLKRSYYMDP QPLNNFEWHL YEYEISKCDA  360
CALYRLELKA VDGKKSAKGK IANESVADLQ KQMGRLTAEF PSDNKRAVKG RTKVNAKVGV  420
GNVYSGSTQV APPNEAYDYG PAPHYDYLVE NLEDYYLTEF KKP*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0012s0820.13.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024455712.10.0transcription factor VOZ1 isoform X2
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLB9H2N90.0B9H2N9_POPTR; Uncharacterized protein
STRINGPOPTR_0004s05030.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]