PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0008s0420.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HD-ZIP
Protein Properties Length: 367aa    MW: 40576.7 Da    PI: 7.3124
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0008s0420.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.69.1e-18195249256
                             T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                             rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  SapurV1A.0008s0420.1.p 195 RKKLRLSKEQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTK 249
                             788899***********************************************98 PP

2HD-ZIP_I/II127.45.9e-41195285192
             HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeL 87 
                             +kk+rlskeq+++LEesF+e+++L+p++K +la+eL+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eL
  SapurV1A.0008s0420.1.p 195 RKKLRLSKEQSAFLEESFKEHNTLTPKQKLALAKELNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQEL 281
                             69************************************************************************************* PP

             HD-ZIP_I/II  88 reelk 92 
                             r +lk
  SapurV1A.0008s0420.1.p 282 R-ALK 285
                             9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-17179245IPR009057Homeodomain-like
SuperFamilySSF466893.42E-18186252IPR009057Homeodomain-like
PROSITE profilePS5007117.281191251IPR001356Homeobox domain
SMARTSM003893.6E-16193255IPR001356Homeobox domain
CDDcd000869.11E-16195252No hitNo description
PfamPF000463.5E-15195249IPR001356Homeobox domain
PROSITE patternPS000270226249IPR017970Homeobox, conserved site
SMARTSM003409.1E-26251294IPR003106Leucine zipper, homeobox-associated
PfamPF021835.6E-11251285IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MELGLSLGDA GTASKPFGFM EKSSKLTSKT NLGFCMGLSI GPNHTPQEDD QDKEKRSNSD  60
HKSDNTNTSA AAAEANKRKS MAEDTTDSPI QLDLLPNTPV PRNQNHSLTY LVSDNGNTSR  120
GFDVNRFPAA MVHEDQGDQD VAALSSSPPN SATSSFQMDF CMYSSKGRSE SHNEADQAER  180
ASSRASDEDE NGSARKKLRL SKEQSAFLEE SFKEHNTLTP KQKLALAKEL NLRPRQVEVW  240
FQNRRARTKL KQTEVDCEYL KRCCETLTEE NRRLHKELQE LRALKTSNPF YMQLPATTLT  300
MCPSCERVAT TSTSTAAATP TATTTTNNQN NTADPTSKTT GLSLSSTRPR FYPFSHTQTH  360
PHQHTS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243251RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0008s0420.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473520.0EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011002298.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466652e-98HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2K2C2640.0A0A2K2C264_POPTR; Uncharacterized protein
STRINGPOPTR_0001s23680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-87homeobox from Arabidopsis thaliana