PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0004s1140.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MIKC_MADS
Protein Properties Length: 226aa    MW: 25209 Da    PI: 8.4718
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0004s1140.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.2e-29959151
                            S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                  SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                            k+i+n + rqvtfskRr g++KKAeELSvLCdaevaviifs tgkl+eyss
  SapurV1A.0004s1140.1.p  9 KKIDNVTARQVTFSKRRRGLFKKAEELSVLCDAEVAVIIFSATGKLFEYSS 59
                            68***********************************************96 PP

2K-box47.48.2e-17841711299
                   K-box  12 akaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                              + +  + ++ +L ke+++  +++R++ GedL+ L+++eLqq+e+ Le +l+++ ++K e ++++i++l +k  +l eenk+L++k+
  SapurV1A.0004s1140.1.p  84 LELQLENSNHMRLSKEVSEKTHQLRRMRGEDLQGLNIEELQQMEKMLEVGLSRVLETKGERVMKEISTLERKGVQLLEENKQLKQKI 170
                             55666777889999****999*****************************************************************9 PP

                   K-box  99 e 99 
                             +
  SapurV1A.0004s1140.1.p 171 A 171
                             7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.7E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.039161IPR002100Transcription factor, MADS-box
CDDcd002657.71E-39275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-31382IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.94886176IPR002487Transcription factor, K-box
PfamPF014861.8E-1490170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MAREKIKIKK IDNVTARQVT FSKRRRGLFK KAEELSVLCD AEVAVIIFSA TGKLFEYSSS  60
SMKDVLARYN LHSNNLDKIN QPSLELQLEN SNHMRLSKEV SEKTHQLRRM RGEDLQGLNI  120
EELQQMEKML EVGLSRVLET KGERVMKEIS TLERKGVQLL EENKQLKQKI AAISKGKKPA  180
LVDLDTAVQE EGMSSESTAN VCSCSSGPPV EDDSSDTSLK LGLAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A9e-21169169MEF2C
5f28_B9e-21169169MEF2C
5f28_C9e-21169169MEF2C
5f28_D9e-21169169MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0004s1140.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5013920.0AY501392.1 Populus tomentosa MADS box transcription factor (MADS1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011016930.11e-156PREDICTED: MADS-box protein JOINTLESS
SwissprotQ9FUY61e-101JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLQ6RF311e-154Q6RF31_POPTO; MADS box transcription factor
STRINGEOY154441e-134(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF89033106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.13e-99MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]