PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0003s0380.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB_related
Protein Properties Length: 773aa    MW: 85087.8 Da    PI: 7.1829
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0003s0380.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162468147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                            r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  SapurV1A.0003s0380.1.p 24 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                            78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-171874IPR009057Homeodomain-like
PROSITE profilePS5129421.0911973IPR017930Myb domain
TIGRFAMsTIGR015578.5E-172271IPR006447Myb domain, plants
SMARTSM007177.3E-132371IPR001005SANT/Myb domain
PfamPF002493.2E-132467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-82464IPR009057Homeodomain-like
CDDcd001671.50E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 773 aa     Download sequence    Send to blast
MDTYSSGEDL VIKTRKPYTI TKQRERWTEE EHNRFLEALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEREAIAKG VPIGHALEIN IPPPRPKKKP GNPYPRKKGV GPPASQVGAK  120
DGKLLTSTSF PHCRNVLELV KEPRPEKRDG DERPTNAKEN QNDNCSEVFT LLQEAHCSSV  180
ASSNKNSVST LEVLKKTSSF REFVPSSKKG NHDAQNESFI TIEHEANQKL DSSDAKQTAW  240
DNGIVKASKS ENYCSLHEKF FQQKKSNDFI GSLPTDEMQA MQNYPRHVPV QVLDGSLGTC  300
METPPSDLSF QDSMFHPIGN IPACPILYSH PARSTTTDHL NNSPRSSMHQ SFQIFPPPFT  360
STHHNQDDYI SFLHLSSTFS SLIVSTLLQN PAAYAAASFA ATFWPYGNVE SSADSPACVQ  420
EGFQSRQINS APSLEAIGAA TVAAATAWWV AHGLLPTCAP LQTAFACPPA SATAIQSADA  480
DAGQAPPAKP KRKETTHENP PLKGQIQDLE HSEVVQAQNS TLKPLTLSST DSKESGGTNL  540
KTGPKVIEHE LTTKALEVQD SSKTKSRKQV DRSSCGSNTP YSSEIETDAL EKTEKGKEEP  600
KEVDADHPAS ESNCRRSRSS SSSSIGDSWK EVSEEGRLAF QALFTREVLP QSFSPPHDLK  660
STMHQKEDTE EKKNPDEKKD VSLFDLNSKT WGGCSHYQEG EKIAIVPRCV NDGEEGLLTI  720
RLGHGNLKAH QTGFKPYKRC SMEAKESRVG TTGGLGEEKG TKRLRLEREA SV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194107RPKKKPGNPYPRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0003s0380.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4294100.0AB429410.1 Populus nigra PnLHY1 mRNA for transcription factor LHY, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006386664.10.0protein LHY
RefseqXP_024451481.10.0protein LHY
TrEMBLB9GRS20.0B9GRS2_POPTR; Uncharacterized protein
STRINGPOPTR_0002s18190.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.18e-84circadian clock associated 1