PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0002s0940.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family GRAS
Protein Properties Length: 559aa    MW: 61988.1 Da    PI: 5.9182
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0002s0940.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS260.37e-801715502374
                    GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevs 88 
                             ++lL  cA a++sg+l+++q+lL  l+elasp+gd+++Rlaa+ ++AL +++++s+++ ++++ + + ++++ +   +al  f+evs
  SapurV1A.0002s0940.1.p 171 EQLLNPCAAAITSGNLSRVQHLLYVLHELASPTGDANHRLAAHGLRALTHHVSSSSTSSSASIGTLTFASTEPKFFQKALLKFYEVS 257
                             689***************************************************9999999999999998888888888888***** PP

                    GRAS  89 PilkfshltaNqaIleavege....ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleet 161
                             P++ f + +aN  Il+ +++e    + +Hi+D+++s+G+QWp+Ll+aL+ Rp ++pp +RiT++ + +++               + 
  SapurV1A.0002s0940.1.p 258 PWFAFPNNIANASILQVLAQEqdptRNLHILDIGVSHGVQWPTLLEALTRRPgGPPPLVRITVITATTENdqstappfsVGPPGDNF 344
                             *******************998888899************************55566*******9987777888888877778899* PP

                    GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh 248
                              +rL  fA+ +++++e++ l    l++l+ + ++ kp+Eal+V+ +++lh+l    +++++er+e+L+++++l+Pk v+++e+++d+
  SapurV1A.0002s0940.1.p 345 SSRLLGFAKFMNINLEIKRLDGYPLQKLNGRIIDAKPEEALIVCAQFRLHNLN---HNTPDERNEFLRVLRKLEPKGVILSENNMDC 428
                             *******************9888*****************************8...66666677********************887 PP

                    GRAS 249 ...nsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsek 332
                                + ++F+++f++ ++y + ++ds+++ +    + r + Er++++ e +++++++g++    +e + kW er+e aGF+   ++e+
  SapurV1A.0002s0940.1.p 429 scnGCGDFAAGFSRRVDYLWRFLDSTSSAF----KGRESEERRMMEGEGSKALTNRGEM----NEGKDKWCERMEGAGFEGEMFGED 507
                             4433469*******************6664....4555555555555678889999988....9*********************** PP

                    GRAS 333 aakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                             a + a++llrk++ ++++r e +++++ l Wk++p+ ++S W+
  SapurV1A.0002s0940.1.p 508 AIDGARALLRKYDsNWEMRTEGKDECVGLWWKGQPVSFCSLWK 550
                             *************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.644144529IPR005202Transcription factor GRAS
PfamPF035142.4E-77171550IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MTIEESEPNH ASDHVMDWLE DSVSFLPTFL DDPYSAADTN PYQWWEQAEE ICQDLDNTNT  60
SLNSSTATST ATNINSANVI SPINPTMSNH PPTSTSTKKR KDPEDPVPKT SQNHNQRKNL  120
NRRISKEEQD GETAVEEVVA VKKSNGNKKS TNKSTGNNSN NGNKKEGKWA EQLLNPCAAA  180
ITSGNLSRVQ HLLYVLHELA SPTGDANHRL AAHGLRALTH HVSSSSTSSS ASIGTLTFAS  240
TEPKFFQKAL LKFYEVSPWF AFPNNIANAS ILQVLAQEQD PTRNLHILDI GVSHGVQWPT  300
LLEALTRRPG GPPPLVRITV ITATTENDQS TAPPFSVGPP GDNFSSRLLG FAKFMNINLE  360
IKRLDGYPLQ KLNGRIIDAK PEEALIVCAQ FRLHNLNHNT PDERNEFLRV LRKLEPKGVI  420
LSENNMDCSC NGCGDFAAGF SRRVDYLWRF LDSTSSAFKG RESEERRMME GEGSKALTNR  480
GEMNEGKDKW CERMEGAGFE GEMFGEDAID GARALLRKYD SNWEMRTEGK DECVGLWWKG  540
QPVSFCSLWK VDMKGNDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-4216755084473Protein SHORT-ROOT
5b3h_B2e-4216755030419Protein SHORT-ROOT
5b3h_E2e-4216755030419Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator essential for Nod-factor-induced gene expression. Acts downstream of calcium spiking. May be a target of DMI3, a calcium/calmodulin-dependent protein kinase (CCaMK) (PubMed:15961669). Is essential for Nod factor-elicited expression of ERN1 (PubMed:23077241). {ECO:0000269|PubMed:15961669, ECO:0000269|PubMed:23077241}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0002s0940.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced after treatment with Sinorhizobium meliloti. {ECO:0000269|PubMed:15961669}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2175880.0AC217588.1 Populus trichocarpa clone POP047-P10, complete sequence.
GenBankAJ9724870.0AJ972487.1 Populus trichocarpa HNO1 gene for Nodulation Signaling Pathway 1 protein homologue 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011036431.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLQ4VYC30.0Q4VYC3_POPTR; Nodulation Signaling Pathway 1 protein homologue 2
STRINGPOPTR_0001s16890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68743447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-146GRAS family protein
Publications ? help Back to Top
  1. Cerri MR, et al.
    Medicago truncatula ERN transcription factors: regulatory interplay with NSP1/NSP2 GRAS factors and expression dynamics throughout rhizobial infection.
    Plant Physiol., 2012. 160(4): p. 2155-72
    [PMID:23077241]
  2. Tang H, et al.
    An improved genome release (version Mt4.0) for the model legume Medicago truncatula.
    BMC Genomics, 2014. 15: p. 312
    [PMID:24767513]