PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0002s0060.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Whirly
Protein Properties Length: 230aa    MW: 24961.7 Da    PI: 10.3058
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0002s0060.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly201.11.4e-62531891137
                  Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsne 87 
                             sv+k+kaal+v++v+ptf++  sgnl+++r+G+++l++ +a++erkyd ek+q+falsatev++l+++++k+sceffhdp++ +sn+
  SapurV1A.0002s0060.2.p  53 SVFKGKAALSVEPVLPTFSKFGSGNLRVDRRGSMMLTFLPAIGERKYDHEKRQKFALSATEVGSLLSMGPKDSCEFFHDPSMLSSNA 139
                             79************************************************************************************* PP

                  Whirly  88 GkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
                             G+vrk l+++P++dGsG+f++lsv n+++k+ e+f+vPv+ aef+vl+++
  SapurV1A.0002s0060.2.p 140 GQVRKNLSIKPHADGSGYFISLSVANNILKTAERFTVPVTTAEFTVLKTA 189
                             ***********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.106.1E-7443206IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.26E-6546227IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.0E-5854188IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MMKLSRFLNS NRNALGKATD VRDGSALHAL TFQAGISTGG KSSIQDRVFA PYSVFKGKAA  60
LSVEPVLPTF SKFGSGNLRV DRRGSMMLTF LPAIGERKYD HEKRQKFALS ATEVGSLLSM  120
GPKDSCEFFH DPSMLSSNAG QVRKNLSIKP HADGSGYFIS LSVANNILKT AERFTVPVTT  180
AEFTVLKTAC SFALPHIMGW DRLTTPVPGT LASKLSKVDP QMPDLEWDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A4e-924720410167Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_B4e-924720410167Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_C4e-924720410167Single-stranded DNA-binding protein WHY2, mitochondrial
4kop_D4e-924720410167Single-stranded DNA-binding protein WHY2, mitochondrial
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements. {ECO:0000269|PubMed:21911368}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSapurV1A.0002s0060.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1460250.0EF146025.1 Populus trichocarpa clone WS0115_A07 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011011443.11e-164PREDICTED: single-stranded DNA-bindig protein WHY2, mitochondrial
SwissprotD9J0349e-98WHY2_SOLTU; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA9PCM91e-161A9PCM9_POPTR; Whirly family protein
STRINGcassava4.1_015441m1e-117(Manihot esculenta)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.13e-98WHIRLY 2