PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0001s0490.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Trihelix
Protein Properties Length: 279aa    MW: 33144.4 Da    PI: 8.1111
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0001s0490.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix77.61.9e-2437119186
                trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                             +W+ qe+++ + +r e++ ++ ++k++k lWe +s++m+++g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  SapurV1A.0001s0490.1.p  37 QWSIQETKEFLMIRAELDPTFMEKKRNKVLWEVISNNMKQKGYNRSAEQCKCKWKNLVTRYKGCETIEPES---MRNQFPFYNELQ 119
                             7********************************************************************84...44579*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122039.90E-2236101No hitNo description
PfamPF138371.6E-2037121No hitNo description
PROSITE profilePS500907.3523894IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MEGHLHHHHH LQQIQQQQQQ QQQHISVNVD TSDRFPQWSI QETKEFLMIR AELDPTFMEK  60
KRNKVLWEVI SNNMKQKGYN RSAEQCKCKW KNLVTRYKGC ETIEPESMRN QFPFYNELQA  120
IFTSRMQRML WAEAEGAASG LKKKAVHLSS DEEDDNEEIS EGEKGAGRKK IKKGKAVGGA  180
SSSGGNSNSF RETLEDFMKQ QMQMEMQWRE TFEARENERR MKEMEWRKTM EGIENERTTM  240
DRIWREIEEQ RRVREEARAE KRDVLITALL NKLRREDM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002308224.11e-151hypothetical protein POPTR_0006s10240g
SwissprotQ9SDW02e-71TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLB9HCX71e-151B9HCX7_POPTR; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-151(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.11e-58Trihelix family protein