PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo8G0031100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family CPP
Protein Properties Length: 876aa    MW: 94601.8 Da    PI: 4.9071
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo8G0031100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.44.5e-16714751340
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +k+CnCkkskClk+YC+Cfaag++C++ C+C++C N+ 
  Spipo8G0031100 714 CKRCNCKKSKCLKLYCDCFAAGVYCTDACTCQGCLNRP 751
                     79**********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-15712753IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163420.079713809IPR005172CRC domain
PfamPF036384.5E-12715750IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 876 aa     Download sequence    Send to blast
MDSPESTIPA PAAPNAAVVS PSGVQESPFF AYVSNLSPIK LSSDVCVPSA IRELSFPSPS  60
PVFTSPHINP VRKDKFLKRS QRLSPESGKF SLGYTGDIRE LLEKTSHYGG ANSQPIMVPC  120
STSTTCEHPT RLQSCSSPSD CVDEFFADPV EDSVNSSALS DFCLDQAIEL GQPSQSGFAS  180
PNKTPKDEPV QFQDCSSSGC IDEILPCQEG DRKANDSFDK FPVVDVVSNS SAEASKEFYP  240
QVGNIKNDEL EIVESPAMAC QAGENPELGI SLIQKNCDQN KDSINVADDG REKNDGQLIP  300
CTKLVAQNAM KYSPSKILAS DLHGFQLAGG HTANSDISVV PESVEDDSRF SKKEKSTIPL  360
DCSDGDYVVL TERVQSMEGD SNSQMQPKSL DVALPDERQL CTSTSLCSTS MNIGVSNEQA  420
CLSSKPQWEG CQLAYAMRRR LEFMHSAGPG TNLESTRNPC NIDERILIAE SPSSSLGLET  480
RNASQNESVG ASGNVLVYSS PELSHFQKNP DPSAHALCEA PLCQHQTAEA NANRFDLSIQ  540
KNGSSSATDP RPAGIGLHLN SVVHAVAKDC DINMQLVDRD LGKDSLTTQL GKELCSSDQN  600
IDDSKGCLPS TSLTSSVSVQ TDVNSHSALV CSSNDKSECD QQKNLDVTAP DYSLSLQYAL  660
ITDPLEICLP PTFVSQVVSP CNVKRTPVGP SISEELNEMS PKKKSKKAPE NDGCKRCNCK  720
KSKCLKLYCD CFAAGVYCTD ACTCQGCLNR PDYVDTVLET RQQIETRNPL AFAPKVVVHD  780
AAASRAYGDD DKHTPASARH KRGCNCKRSH PKLVVLWDAG VKDAKIAMAQ KMVYKKELQL  840
SSAHMKIYQQ SNIFFEKINT LVSTDPKENV TGNGI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-42TESMIN/TSO1-like CXC 2