PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo7G0016700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 322aa    MW: 34802.8 Da    PI: 7.2618
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo7G0016700genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260110.31.4e-3447143197
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkC++dC+lapyfpa+q++ f n+h+lFG+sn+lk+l+ l++++r +am+ +++++++r +d v G++++i+++++q+e l+a+l+
  Spipo7G0016700  47 ACAACKYQRRKCNPDCTLAPYFPADQQRYFLNAHRLFGVSNILKTLRGLDHTQRAIAMKNITFQSNMRSQDIVGGCFRIIFDIRRQIEALSADLN 141
                     7*******************************************************************************************998 PP

          DUF260  96 ll 97 
                     +l
  Spipo7G0016700 142 QL 143
                     75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.19646147IPR004883Lateral organ boundaries, LOB
PfamPF031951.4E-3247142IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MSASTGATSG NSQPQGPHHH LHTHSRRSSA GGAGSGSPGG AASPTQACAA CKYQRRKCNP  60
DCTLAPYFPA DQQRYFLNAH RLFGVSNILK TLRGLDHTQR AIAMKNITFQ SNMRSQDIVG  120
GCFRIIFDIR RQIEALSADL NQLVRYLALR SAQAQARATS QPFLPDPNVI ENSIADDHQL  180
QQQQPFLYYC GGGGGGGGGG ETSSSIIKTQ EAALDPPPPS SSPLRLCGAD LGQDLQRQEN  240
NEGDQGKPPL DMFEFRQHQP TTFPEPVEQE NVQKGVSTLD FSMAKLEMAE HNDNMLGQVQ  300
ERELKSAASL LKLTNCDLSG R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-22331461114LOB family transfactor Ramosa2.1
5ly0_B7e-22331461114LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703063e-43HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.14e-33LOB domain-containing protein 22