PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo5G0062500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 137aa    MW: 14363.5 Da    PI: 8.9217
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo5G0062500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.42.3e-1983116134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     C+ Cg t+TplWR+gp g+k+LCnaCG++y+k++
  Spipo5G0062500  83 CTMCGRTETPLWRHGPHGPKSLCNACGIRYKKEE 116
                     ********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.2E-1577128IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-1381125No hitNo description
PfamPF003201.5E-1783117IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.38783133IPR000679Zinc finger, GATA-type
CDDcd002027.65E-1383114No hitNo description
Gene3DG3DSA:3.30.50.105.4E-1683119IPR013088Zinc finger, NHR/GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MEFASAVLAG AASPSPAPTS DGKPKYPVEE DLLSLLGDSG GVDCTLKLAL PGCAASRCPR  60
TPAADVASLL RRPDSMAKPA GWCTMCGRTE TPLWRHGPHG PKSLCNACGI RYKKEEKQSR  120
LTLGTPTSHW KTKLSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24183892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18380.14e-14GATA transcription factor 20