PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0088300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family bZIP
Protein Properties Length: 374aa    MW: 41179.7 Da    PI: 6.5164
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0088300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.12.5e-10182240563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+   + l +e+
  Spipo4G0088300 182 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTMLQRDNSGLNAEN 240
                     9***********************************************99988887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-15178242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875180243IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-9182237No hitNo description
PfamPF001706.3E-9182240IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.22E-11182234No hitNo description
CDDcd147033.42E-24183233No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MEKEKSPAHE TAHFGQLDSG RFSNDISRMS DFPPRNVGHR RAHSEILSLP DDISFDSDLG  60
VVGSVEGPSM SDETEEDLLS MYIDMEKFSS SSELSGSMAL QVGESSGTAP DAAKSAPLQP  120
DNMPSGTNDR PRIRHQHSQS MDGTTSIKPE LLAAGADGYL SADAKKAMSA AKLADLALID  180
PKRAKRIWAN RQSAARSKER KMRYIAELER KVQTLQTEAT TLSAQLTMLQ RDNSGLNAEN  240
NELKLRLQTM EQQVHLQDAL NDTLREEVQR LKLVTGQAMP NGSQMMNLGS SFGGTQPFYS  300
HNHHTVQSLL AAQQLQQLQL HSQRQQQLHP SQHNHPQPQQ PGPENKAKVP LTSPSQNQSQ  360
RDSTSDSKDM QVQ*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008791799.11e-157transcription factor RF2a-like isoform X1
SwissprotQ040881e-129POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A1D1Y1W01e-168A0A1D1Y1W0_9ARAE; Putative transcription factor PosF21
STRINGXP_008791799.11e-157(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-121bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]