PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0084000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 230aa    MW: 24623.7 Da    PI: 8.1626
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0084000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.27.1e-44201191100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC++dCv+apyfp +qp+kfa vhk+FGasnv+kll++l + +reda++sl+yeAe+r+rdPvyG+vgvi+ lq+ql+ql+ +l 
  Spipo4G0084000  20 PCAACKFLRRKCQPDCVFAPYFPPDQPQKFAHVHKVFGASNVTKLLNELTPYQREDAVNSLAYEAEMRLRDPVYGCVGVISILQHQLRQLEMDLT 114
                     7*********************************************************************************************9 PP

          DUF260  96 llkee 100
                      +k+e
  Spipo4G0084000 115 CAKSE 119
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.98419120IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4320117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MTTSSSAGTP VTSTSSTSSP CAACKFLRRK CQPDCVFAPY FPPDQPQKFA HVHKVFGASN  60
VTKLLNELTP YQREDAVNSL AYEAEMRLRD PVYGCVGVIS ILQHQLRQLE MDLTCAKSEL  120
SKYQATTTTT LGHGLLNVNI NHPIGIGGIG LGREQFFSAA PAREHHHHHH HMGARTYDAD  180
MGGRLGGSGS YDTGFMAGMN MSAGLGALGS QFNKPRTAGG DERQTIGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-55131234114LOB family transfactor Ramosa2.1
5ly0_B3e-55131234114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927922.11e-104LOB domain-containing protein 6
SwissprotA2WXT02e-78LBD6_ORYSI; LOB domain-containing protein 6
SwissprotQ8LQH42e-78LBD6_ORYSJ; LOB domain-containing protein 6
TrEMBLA0A1D1YBI81e-111A0A1D1YBI8_9ARAE; LOB domain-containing protein 6
STRINGXP_008807271.11e-100(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.45e-66LBD family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]