PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0026900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GeBP
Protein Properties Length: 348aa    MW: 38506.5 Da    PI: 8.5743
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0026900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57391.87.9e-29147241297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +f+r+wseeDe+ lLq+lid++++ g++ps+ id +++ ++  +++++s+sq+ eKirrLK+Kf+  v+k  + + p + k+hd+ +fels+kiW
  Spipo4G0026900 147 AFERVWSEEDEMKLLQALIDCQEEYGVEPSSSIDLIHRHIRVTLHMEFSRSQVYEKIRRLKQKFEATVSK-MRSNPPGVIKPHDRAMFELSQKIW 240
                     599*******************************************************************.889999****************** PP

          DUF573  97 g 97 
                      
  Spipo4G0026900 241 T 241
                     6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.5E-27148240IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVTDATKKSR KTPPAASPGK RKPRKLQRGP EASPLGAESE ELPSDPEGAS LGEKIKIANI  60
AKVPGGEKLE NSKGSDAPPV EEKKTENQSD PDAADGEGKK KKSGSKRKNK EVEIETPEEE  120
SMKRRRQNDR EPSGKEAFLN SAHKKGAFER VWSEEDEMKL LQALIDCQEE YGVEPSSSID  180
LIHRHIRVTL HMEFSRSQVY EKIRRLKQKF EATVSKMRSN PPGVIKPHDR AMFELSQKIW  240
TAEQVAPPVT AMGNEYTGVG ATEEEAGASL PHPYLRDAVS QLEKETGYYA GGSITKGFQL  300
LKPSEAAKLE KSWKAHCSAS MKIFFENCKL KNELLQACIQ ALESHTP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105125KRKNKEVEIETPEEESMKRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97437123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.15e-19DNA-binding storekeeper protein-related transcriptional regulator