PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0004100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family G2-like
Protein Properties Length: 368aa    MW: 40236 Da    PI: 9.9456
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0004100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32206259255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Spipo4G0004100 206 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 259
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15203260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-29204260IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-24206259IPR006447Myb domain, plants
PfamPF002496.2E-7207258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MAGGAATTDL WRRIGSLIPR SDCPQTPIDL SLANPCDAAE IPWRTQSTTP EGLRPPTAFG  60
HCHADLRSAH GGAPPSSVEG MRPIRGIPVY HTGPFPFFPG EPKTGFRQQI PTFPSWTSPP  120
PPSCSSNLEP TVVGPPYYHH HHRTAAAAAR INGVSPESMV MMMRADHHLH QQPQQQFSMG  180
SFDGSHAMAR SRFVPKLPAK RSMRAPRMRW TSTLHARFVH AVELLGGHER ATPKSVLELM  240
DVKDLTLAHV KSHLQMYRTV KSTDKPAASS EFQDRGVFQC SDSALSSNPS PLMDFPLYFC  300
LESIIKKKLQ TLSLLSLSHT KILPSPSKFK SINMPTPGWV TPMETAVGSV SRRTGDIAGQ  360
GPDYLNS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16207261357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16207261357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16207261357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16207261357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16207261458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0TSU37e-66M0TSU3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P22900_0011e-66(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-47G2-like family protein