PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0091000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family CPP
Protein Properties Length: 795aa    MW: 86475.2 Da    PI: 6.0368
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0091000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25e-16458495340
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     +++CnCkkskClk+YCeCfaag++C   C Ce+C Nk 
  Spipo3G0091000 458 CRRCNCKKSKCLKLYCECFAAGVYCVGPCACEGCLNKP 495
                     789*********************************96 PP

2TCR51.81.6e-16542581140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Spipo3G0091000 542 RHKRGCNCKKSGCLKKYCECYQGGVGCSASCRCEGCKNTF 581
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.7E-15456497IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.143457582IPR005172CRC domain
PfamPF036381.6E-11459494IPR005172CRC domain
SMARTSM011144.0E-18542583IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.0E-12544580IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
MAAPLEREPK RVRRMLLKLL QPSEEGEYPA LDSSAPDFSS EDGDGKSLSC VIPNLLKLSE  60
CVIDEKASFK TKCLLNEATV DPPEECQNLT SHLSTSLEYD CGSPNHNTAP CYGSQNKVDL  120
KRVRVSLVDF ACDVQEAVES SANDIEGGDI HCQGHIKEEV SGCDWENLIT DGSVNLFVFD  180
PSTESEACEE CCQKIKGPDT NYSTSYSLRI SEHSIGDPQR SLPDGALATC LPSTTIDVSE  240
DYGQQVFSQN NCEHTPQVPP TCQQNNQEVS DQFEKMDDED DDHELFGNET DYQHQRGFRR  300
RCLVFEVAGS HVIGDSKDNV SASFPINLKH VSGDKQQNFS KPSPSRRQHA LPSIGLHLNS  360
LATSSKVRIA TEDNLPSGRK LLSLPCSTGT ISSLITVQKP SSGSSVTEED LCPGSDPREL  420
TDMQNSLQSP AISGEELDLN SPRKKKCKPE ISGDHGSCRR CNCKKSKCLK LYCECFAAGV  480
YCVGPCACEG CLNKPIHEDI VLATRKQIES RNPLAFAPKV IRASAPATGI GEEINKTPAS  540
ARHKRGCNCK KSGCLKKYCE CYQGGVGCSA SCRCEGCKNT FGRREGVLPM VNEETEPKEE  600
QHVDLCGDNG VEFPHEADGL HGDKQFPDND LPVTPSFQTT RLIPIAIFLP ISFASVQLNL  660
QLLTSSIAPP HRPPLRPPFS FSEKPPRSSA ASVGSSPLLS ACHKLQKPLL PKSKLEKHFQ  720
TAPEEETPQI LREMPSPLSG VKTASPSRKR VSPPHHELGS SPSRKGGRRL ILRSIPSFPP  780
LSGISSGDPP EAAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1846157914120Protein lin-54 homolog
5fd3_B1e-1846157914120Protein lin-54 homolog
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A1D1Z8B60.0A0A1D1Z8B6_9ARAE; Protein lin-54
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-77Tesmin/TSO1-like CXC domain-containing protein