PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0015500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family ZF-HD
Protein Properties Length: 89aa    MW: 9592.69 Da    PI: 8.8004
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0015500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.21.7e-321975259
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                    + vrY eC+kNhAa++GghavDGC+Efmp+ g egta al+CaAC CHR+FHRreve+
  Spipo3G0015500 19 RVVRYAECRKNHAARIGGHAVDGCREFMPA-GGEGTAGALQCAACSCHRSFHRREVED 75
                    579**************************9.8899********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257744.0E-172169IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.0E-292173IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.3E-262273IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3452372IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGPQQEPGKH QRSSAARKRV VRYAECRKNH AARIGGHAVD GCREFMPAGG EGTAGALQCA  60
ACSCHRSFHR REVEDDVLRD RSSDSATL*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246148.15e-33PREDICTED: mini zinc finger protein 2-like
SwissprotQ9CA512e-26MIF1_ARATH; Mini zinc finger protein 1
TrEMBLA0A1U7YZP31e-31A0A1U7YZP3_NELNU; mini zinc finger protein 2-like
STRINGXP_010246148.12e-32(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74660.11e-24mini zinc finger 1