PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo3G0001400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 217aa    MW: 23557.8 Da    PI: 8.7789
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo3G0001400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.72.6e-40421411100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p kf +vhk+FGasnv+k+l ++pe +r da++sl+yeA++r+rdP+yG++g i++lqqq++ l++el 
  Spipo3G0001400  42 PCAACKLLRRRCAQECPFSPYFSPHEPLKFSAVHKVFGASNVSKMLMEVPEPQRADAANSLIYEANIRLRDPIYGCMGAISALQQQVQALEEELR 136
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Spipo3G0001400 137 AVRAE 141
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.47341142IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4042139IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 217 aa     Download sequence    Send to blast
MSTGRENLNE AGKRIKREAN VGDRIGRRHL LGPQGILNTV TPCAACKLLR RRCAQECPFS  60
PYFSPHEPLK FSAVHKVFGA SNVSKMLMEV PEPQRADAAN SLIYEANIRL RDPIYGCMGA  120
ISALQQQVQA LEEELRAVRA EILKQKYRQN SENIMPPTPY SGVSSTGVVS VAVPPPIPTP  180
SPPPHAPSTS SSSMYTPPSC STDYSSVTNE NAPYYG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-404214411113LOB family transfactor Ramosa2.1
5ly0_B2e-404214411113LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009399908.11e-102PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T55e-71LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A3S3NG721e-100A0A3S3NG72_9MAGN; LOB domain-containing protein 15
STRINGGSMUA_Achr5P07460_0012e-99(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26303891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-66LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]