PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0120800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 186aa    MW: 20693.4 Da    PI: 9.0464
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0120800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.23e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vh++FGasnv kll++l+ e+reda++sl+yeAear+rdPvyG+vg i+ lq++l+ql+++l 
  Spipo2G0120800   7 PCAACKFLRRKCTAGCVFAPYFPPDQPAKFASVHRVFGASNVAKLLNELSSEQREDAVNSLAYEAEARLRDPVYGCVGYISVLQHRLKQLQEDLL 101
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                      +k+e
  Spipo2G0120800 102 NAKKE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.046107IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-437103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
SSSTNSPCAA CKFLRRKCTA GCVFAPYFPP DQPAKFASVH RVFGASNVAK LLNELSSEQR  60
EDAVNSLAYE AEARLRDPVY GCVGYISVLQ HRLKQLQEDL LNAKKELSSY IRPTTASNPF  120
LTATTAAAQQ SFPPTNRGHL FNYHHHHSLP SGASPSAITL REQQCHRLQI VEAQRLTREP  180
NNDMLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-5111105114LOB family transfactor Ramosa2.1
5ly0_B6e-5111105114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026661227.17e-68LOB domain-containing protein 6-like
SwissprotQ9FKZ32e-65LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A200R7A84e-67A0A200R7A8_9MAGN; Uncharacterized protein
TrEMBLA0A3Q0I7372e-66A0A3Q0I737_PHODC; LOB domain-containing protein 6-like
STRINGXP_008792635.13e-67(Phoenix dactylifera)
STRINGXP_008792769.17e-68(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-68ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]