PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0051800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 87aa    MW: 9994.43 Da    PI: 8.7689
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0051800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26070.24.5e-2218861987
          DUF260 19 apyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqql 87
                    + yfp+e++++f+nv+++FGa+nv ++l++lp+  r da++sl++eAe+++ +Pv+G++g i  lq+ql
  Spipo2G0051800 18 RAYFPQEESARFKNVNRVFGANNVARILNDLPPGSRWDAVTSLCFEAEMQLLEPVKGCFGYIEFLQRQL 86
                    68****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089113.442186IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-201886IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MRGVQTFASE LRSWVRHRAY FPQEESARFK NVNRVFGANN VARILNDLPP GSRWDAVTSL  60
CFEAEMQLLE PVKGCFGYIE FLQRQL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2220863197LOB family transfactor Ramosa2.1
5ly0_B2e-2220863197LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545391e-111AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022883969.19e-22LOB domain-containing protein 25-like isoform X1
RefseqXP_022883970.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883971.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883972.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883973.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883974.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883975.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883977.19e-22LOB domain-containing protein 25-like isoform X2
RefseqXP_022883978.19e-22LOB domain-containing protein 25-like isoform X2
SwissprotQ8L8Q31e-20LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A2I0HZI81e-20A0A2I0HZI8_PUNGR; Uncharacterized protein
STRINGXP_008792635.18e-20(Phoenix dactylifera)
STRINGXP_008792769.14e-20(Phoenix dactylifera)
STRINGXP_010037527.17e-20(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.15e-23LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]