PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0051600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 212aa    MW: 23430.5 Da    PI: 7.3102
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0051600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601261.9e-3981071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++C++apyfp+e++++f nvh++FGasnv k+l+++p+  r+da+ sl++eAe+ + dPv+G++g i++lq++l++l++++a
  Spipo2G0051600   8 PCAACKFLRRKCVPGCIFAPYFPQEESARFVNVHRVFGASNVAKILNDVPPASRRDAVISLCFEAEVHLLDPVNGCLGYIQNLQNHLHKLHHDIA 102
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+k+e
  Spipo2G0051600 103 LVKAE 107
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.4637108IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-398105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MASSSSSPCA ACKFLRRKCV PGCIFAPYFP QEESARFVNV HRVFGASNVA KILNDVPPAS  60
RRDAVISLCF EAEVHLLDPV NGCLGYIQNL QNHLHKLHHD IALVKAEIHA LDLLEGRVGA  120
PWAMPPSLPM AQEPPYHHPP QMTERQDVFQ GGDQPEHQQH GAHPHHQLGT MRYNEGIMNS  180
GGGPPTVLGL APQQFHNAVN RHPYHHDQRQ N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4051308128LOB family transfactor Ramosa2.1
5ly0_B2e-4051308128LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545390.0AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026661227.17e-43LOB domain-containing protein 6-like
SwissprotQ9FML41e-41LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A3Q0I7372e-41A0A3Q0I737_PHODC; LOB domain-containing protein 6-like
STRINGXP_008792635.13e-42(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16457913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-37LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]