PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0051500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 197aa    MW: 21592.1 Da    PI: 4.5972
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0051500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.66.6e-3691072100
          DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                     CaaCk++rrkC+++C++apyfp+e +++f nv+++FG s   k+l+++p+  r+da+ sl++eAe+ ++dPv+G++g i + q+ql+ql++++a+
  Spipo2G0051500   9 CAACKHMRRKCVPGCIFAPYFPQEWSARFMNVNRVFGPSDEAKILNDVPPASRPDAVISLCFEAEVHLQDPVNGCLGYIETFQRQLQQLHQDIAM 103
                     **********************************************************************************************9 PP

          DUF260  97 lkee 100
                     + ++
  Spipo2G0051500 104 VTAQ 107
                     9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.2727108IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-349104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MASSSGSTCA ACKHMRRKCV PGCIFAPYFP QEWSARFMNV NRVFGPSDEA KILNDVPPAS  60
RPDAVISLCF EAEVHLQDPV NGCLGYIETF QRQLQQLHQD IAMVTAQIHA LDVLEGAAPP  120
PPSMMQDASY YPPLQITERQ DVLQSGGQHQ DQDQDHGISP HEQLDTRSYD GGITDSEGGP  180
STELTLAPPQ EQMRQK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-3551018104LOB family transfactor Ramosa2.1
5ly0_B6e-3551018104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545390.0AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026661227.13e-35LOB domain-containing protein 6-like
TrEMBLA0A411F6V92e-34A0A411F6V9_9MONI; AS2 protein
STRINGXP_008792635.11e-34(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52283461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.46e-36LBD family protein