PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0051400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 89aa    MW: 9872.36 Da    PI: 7.0102
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0051400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26076.64.3e-241087384
          DUF260  3 aaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84
                    aaCk+l +kC + Cv+ py+p+e+++kf n+ ++FGa+nv k+l+++ +  ++da++sl++eA+    dP++G++g i++lq
  Spipo2G0051400 10 AACKYLHEKCIPCCVFTPYLPQEESAKFMNMYHFFGARNVAKILNHVLPVSHRDAVTSLYFEAD----DPINGCLGYIQALQ 87
                    8*************************************************************96....***********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089115.01788IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-231088IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MASSSSPAYA ACKYLHEKCI PCCVFTPYLP QEESAKFMNM YHFFGARNVA KILNHVLPVS  60
HRDAVTSLYF EADDPINGCL GYIQALQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2410881395LOB family transfactor Ramosa2.1
5ly0_B2e-2410881395LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545391e-122AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022004798.19e-27protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML48e-24LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A251VF392e-25A0A251VF39_HELAN; Putative LOB domain-containing protein
TrEMBLA0A2N9ITT44e-25A0A2N9ITT4_FAGSY; Uncharacterized protein
STRINGXP_010029135.17e-25(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-26LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]