PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0051300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 200aa    MW: 21856.8 Da    PI: 6.9882
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0051300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601278.6e-4081071100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++C++apyfp+e++++f nvh++FGasnv k+l+++p   r+da+ sl++eAe+ ++dPv+G++g i++lq++l+ql++++a
  Spipo2G0051300   8 PCAACKFLRRKCVPGCIFAPYFPQEESARFVNVHRVFGASNVAKILNDVPLASRRDAVISLCFEAEVHLQDPVNGCLGYIQNLQNHLHQLHQDIA 102
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++k+e
  Spipo2G0051300 103 KVKAE 107
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.0577108IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-398105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MASSSSSPCA ACKFLRRKCV PGCIFAPYFP QEESARFVNV HRVFGASNVA KILNDVPLAS  60
RRDAVISLCF EAEVHLQDPV NGCLGYIQNL QNHLHQLHQD IAKVKAEIHA LDLLEGRVGA  120
PWAVPPSLPM AQEPPYHHPP QMTERQDVFQ GGDQPEHQQH GAHPHQQLGT MRYNEGIMNS  180
GGGPPTVLGL APQQFHNAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4051308128LOB family transfactor Ramosa2.1
5ly0_B3e-4051308128LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2545390.0AC254539.1 Spirodela polyrhiza clone GNAS837-M21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026661227.16e-43LOB domain-containing protein 6-like
SwissprotQ9FML41e-41LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A3Q0I7371e-41A0A3Q0I737_PHODC; LOB domain-containing protein 6-like
STRINGXP_008792635.12e-42(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16457913
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.44e-37LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]