PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0049500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GeBP
Protein Properties Length: 380aa    MW: 41244.2 Da    PI: 10.5503
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0049500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573851.1e-26123217297
          DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     +fqr+wse+Dei +LqGl+ + +++g+    d++  ++ +++ +s  +s+sql+eK+rrL+kKf+ ++ ++++g +ps  ++hd++ f+ls  +W
  Spipo2G0049500 123 KFQRIWSESDEIRFLQGLLAC-NTQGMTFPRDLNLYFDRFSETMSQPYSRSQLSEKLRRLRKKFRSHSVRVSRGLDPSGLSPHDRDLFHLSTLLW 216
                     79*******************.788999999**************************************************************** PP

          DUF573  97 g 97 
                     +
  Spipo2G0049500 217 D 217
                     8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.1E-26124217IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MRGTRGRIII VRSGGRQVAA REGSAAEDEE GSTTPQAKAS RGGPDRSPRG PMATPSPQAL  60
AQTKSAVRKL PVKRRTPDPA VPRSSASAAA VKTEGEGDEF EDEEEEEEEG EEGRAAGGGA  120
PFKFQRIWSE SDEIRFLQGL LACNTQGMTF PRDLNLYFDR FSETMSQPYS RSQLSEKLRR  180
LRKKFRSHSV RVSRGLDPSG LSPHDRDLFH LSTLLWDPAF AVSSPFGPST GSVPGNKRRR  240
HIPVGKAMAG APPSPPRPSP VGPAPSSSPP LAPPSGKRAG DSGSGSREDH QSPLREGKLF  300
GDGRSGLGQV AAMMALDVFD SCLRDVRATM VRRGLLHSDQ NPRTGVDRDL SKRWREQRVA  360
ELDLLARRLR LTLEQAVED*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G11510.12e-16DNA-binding storekeeper protein-related transcriptional regulator