PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0028900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRF
Protein Properties Length: 302aa    MW: 33742.9 Da    PI: 9.287
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0028900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC80.31.8e-2581124144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrg++rsrk++e
  Spipo2G0028900  81 DPEPWRCRRTDGKKWRCSKEAFPDSKYCERHMHRGKNRSRKPVE 124
                     79***************************************997 PP

2QLQ61.32.6e-211045237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FTa+Q+q+L++Q+l++Ky+a+++PvP++L+ +i++
  Spipo2G0028900 10 PFTASQWQELEHQALIFKYMASGAPVPQDLIGPIRR 45
                    9******************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.6E-11945IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.261045IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.1E-161044IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.28781125IPR014977WRC domain
PfamPF088793.9E-2182124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMNGSSSRCP FTASQWQELE HQALIFKYMA SGAPVPQDLI GPIRRSLYLE PASTSPMLLF  60
HHQPNIGWGC FQMGFGKKVE DPEPWRCRRT DGKKWRCSKE AFPDSKYCER HMHRGKNRSR  120
KPVEISIAAT STPAAAPTSP SLYPGHHLSM VTAAETQHLL NPYAASSRGH DFIRDPSSSS  180
DRNRHGMKEP VDHQRDASWR FTPLGLSPLG ERRQRSCSFL SQDSGAAAQD EKRRHCFVLG  240
TDIRAERGSE ASRPVSFLTE EWSPKGRDER AGWGAIPMTQ LSISMAHYDF QVDSSRSAAG  300
N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010917179.17e-83growth-regulating factor 1
TrEMBLA0A2H3XPD21e-80A0A2H3XPD2_PHODC; growth-regulating factor 1-like
STRINGVIT_11s0016g01250.t015e-71(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-49growth-regulating factor 5