PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo29G0016000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 115aa    MW: 12483.1 Da    PI: 5.0089
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo29G0016000genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26058.81.5e-1835647100
           DUF260  47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      ++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+ ql+ +la++++e
  Spipo29G0016000   3 QELPFQQRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVTQLQMQLAVAQAE 56 
                      68899*********************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.298157IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-16354IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
HRQELPFQQR ADAVSSLVYE ANARMRDPVY GCVGAISYLQ NQVTQLQMQL AVAQAEILCI  60
QMQQEAAGLG SHAMEADEKS FLLHGGLAGV PQFMSFGSSS NVTQDPPKKE SLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-1835857112LOB family transfactor Ramosa2.1
5ly0_B5e-1835857112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921015.12e-54LOB domain-containing protein 12
SwissprotQ8LBW34e-36LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2H3YVF98e-53A0A2H3YVF9_PHODC; LOB domain-containing protein 12
STRINGXP_008804108.11e-53(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-38LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]