PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo23G0032200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 214aa    MW: 22665.2 Da    PI: 7.2734
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo23G0032200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.71.5e-41511501100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC++ Cvlap fp ++p kf ++hk+FGasn++kll+ lpe++r da++s+vyeA+ar+rdPvyG++gvi++lq++l +l+a++
  Spipo23G0032200  51 PCAACKILRRKCTDTCVLAPFFPPDDPLKFTAAHKVFGASNIIKLLQGLPESQRGDAVKSVVYEANARLRDPVYGCAGVIWQLQRRLGELQAQV 144
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Spipo23G0032200 145 ARAEAE 150
                      999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.71850151IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4151148IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
PPAFEFRLIM PHVLTDVPPL RSHPSSPTSS SPPILPSPPP PPPPPEVVPS PCAACKILRR  60
KCTDTCVLAP FFPPDDPLKF TAAHKVFGAS NIIKLLQGLP ESQRGDAVKS VVYEANARLR  120
DPVYGCAGVI WQLQRRLGEL QAQVARAEAE LFTVQSQRAN LIAVLCMKMA AAPSSPDGLA  180
GGGATIPLQN DPSCFLNDDG GGQAAPPWEP LWA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-385015210112LOB family transfactor Ramosa2.1
5ly0_B8e-385015210112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011027000.15e-70PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-59LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1D1ZH963e-73A0A1D1ZH96_9ARAE; LOB domain-containing protein 1
STRINGXP_006485928.17e-69(Citrus sinensis)
STRINGXP_006436214.14e-69(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26453790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-58LOB domain-containing protein 1