PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo20G0037400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family M-type_MADS
Protein Properties Length: 366aa    MW: 40549.1 Da    PI: 6.592
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo20G0037400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.63.4e-23953145
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     kr en+s rqvt+skRr+gilKKA+ELS+LCd+++ +++fs+tgk
  Spipo20G0037400  9 KRLENTSGRQVTYSKRRAGILKKAKELSILCDIDIVLLMFSPTGK 53
                     789****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.273153IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-31160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-18323IPR002100Transcription factor, MADS-box
PfamPF003195.8E-201154IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004043.9E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MGRVKLKIKR LENTSGRQVT YSKRRAGILK KAKELSILCD IDIVLLMFSP TGKPTLCLGE  60
RSTIEEVVAK FAQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSS SQTIEELTNH  120
SRLLQAQLAE VQKRLSYWED SGKTSNLEHI RAVEESLKES LNRIRLQKDS YAKQQLMPFE  180
CAGQFQNTTH LPLVVADEQQ PQPLAWLQGH DYHHMLLPDD GNLIGPRDMD CSMGTALPCY  240
SGYFGTDRPT EEAKGSQEAP GIELTQNGCL SLQLGGQHPF DPSGIHPLGD RFKPEAGVNF  300
PEGGAVDFQG NFPAFDSSIQ NWASSSGSCC LSMFDENSYP QVGCYLKLSL SGPPVKLVIR  360
SECSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-13196194MEF2C
5f28_B2e-13196194MEF2C
5f28_C2e-13196194MEF2C
5f28_D2e-13196194MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020255477.11e-153agamous-like MADS-box protein AGL30
SwissprotQ7X9I05e-95AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A443PT271e-159A0A443PT27_9MAGN; Transcription factor
STRINGXP_008797164.11e-150(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.12e-97AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]