PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0104600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 404aa    MW: 42516.6 Da    PI: 5.4972
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0104600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-18306340135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++Cg+ kTp+WR gp g ktLCnaCG++y++ +l
  Spipo1G0104600 306 CTHCGVDKTPQWRAGPMGAKTLCNACGVRYKSGRL 340
                     *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169924.0E-7539385IPR016679Transcription factor, GATA, plant
SMARTSM004015.2E-16300350IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.701300336IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.03E-15302363No hitNo description
Gene3DG3DSA:3.30.50.102.1E-14304338IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.09E-14305352No hitNo description
PROSITE patternPS003440306331IPR000679Zinc finger, GATA-type
PfamPF003201.1E-16306340IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MDCVETAVLR KAGLQREMVM YSSSSTAAAA ALSGHWQCQQ SSPCFPYPAP AEEDFSVDDL  60
LDLGDGKELS SDMEDFLEVE EEEEEEEGKE SPIDLDASSV LSFQAPPPSE PIVPAGDVAD  120
LEWVSRFVDD SYSEFPAAVA PFPAASKTVA PPKDQVAGSN ASWKRTWGSC CFSTDTLVVP  180
AKARSKRSRS GGRVWSLDRP LLFAESSSSS CSSGSSSSSS CSASSTISSC LLHENLGGSG  240
GGGNPDLFPD SVSGRSLLLT LEQQPPQQLQ LPVKKKKGRK PKALGAATAA GDGAAAGELP  300
QTRRRCTHCG VDKTPQWRAG PMGAKTLCNA CGVRYKSGRL LPEYRPAGSP TFVSHIHSNS  360
HRKVLEMRRK KETLDAAAPV SGGAACSPLP PLLAVAPQPY GVV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009398099.12e-63PREDICTED: GATA transcription factor 5-like isoform X1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-38GATA transcription factor 5