PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0098300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 645aa    MW: 71412.5 Da    PI: 6.1556
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0098300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS402.64e-1232586281373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+lL++c+e + s+++e+++ +L rl elasp g++++RlaayfteAL  r+++ +++++++ p +e  ++ ++++++al++++ vsP+l+f h
  Spipo1G0098300 258 LVNLLTACVESIGSRNHEATTFFLGRLGELASPGGSTVHRLAAYFTEALVLRVVKLWPHIFSIAPRRELLDRMEDDSTMALRVLNGVSPVLRFIH 352
                     689*******************************************************************999********************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +t N+ +l+a++g+er+HiiDfdi+qGlQWp+L+q+LasRp++p+++RiTgvg+    sk+el+etg rLa fAe+l++pfef++ v++rled++
  Spipo1G0098300 353 FTINERLLRAFQGKERIHIIDFDIKQGLQWPSLFQSLASRPNPPAQVRITGVGE----SKQELQETGARLAAFAEALNLPFEFHA-VVDRLEDVR 442
                     ******************************************************....***************************.7******** PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     l++L+vk+++++aVn+vlqlh+ll ++   +   +++L l++s++P++v ++eqea  n++++ +rf+++l+yysa+fd++++ lp es +r+kv
  Spipo1G0098300 443 LWMLHVKERDSVAVNCVLQLHKLLYDDSGAAL--TDFLGLIRSTNPEIVLIAEQEAANNDPRWETRFASSLQYYSAVFDMVDSCLPLESPARVKV 535
                     ***********************977766666..89*********************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee......sgslvlgWkdrpLvsvSaW 373
                     E++ l+rei+n+v+  g er+erhe +++Wr+++ee GF+ + ++e++    ++llr+++ + y +e++       g l+l W d+pL++vSaW
  Spipo1G0098300 536 EEM-LAREIRNIVSGDGGERVERHEVFGEWRKMMEERGFRCAGIGERERLLSQMLLRMFACKSYGLENQgeeehgGGGLTLRWLDQPLYTVSAW 628
                     ***.********************************************************888*9995555566678899************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.27232603IPR005202Transcription factor GRAS
PfamPF035141.4E-120258628IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MLAGCSSTLL SLRHRLRSEA SVPFQACHLQ VQEDLYPSQQ KMSTQRLDLP CSFSRKEGPR  60
IALSLDKAIE TTGGCSFRHN PAAPSSSSSS LVAHGASWES RRDAEGAYWE RSAPGLKRFH  120
EWTSFDDHVE ERIKRKKIGS DRQQLPGGGD GGWFPNNTVE RPQMEQEDRP RFLPGVAVFP  180
PLPCSSAAVA DRVEAEVGTS EGSKQNVKSD TGSSSGSRSS SPDLNENSSD YPHGREAREA  240
VPGDGGDAAK LVHQGLELVN LLTACVESIG SRNHEATTFF LGRLGELASP GGSTVHRLAA  300
YFTEALVLRV VKLWPHIFSI APRRELLDRM EDDSTMALRV LNGVSPVLRF IHFTINERLL  360
RAFQGKERIH IIDFDIKQGL QWPSLFQSLA SRPNPPAQVR ITGVGESKQE LQETGARLAA  420
FAEALNLPFE FHAVVDRLED VRLWMLHVKE RDSVAVNCVL QLHKLLYDDS GAALTDFLGL  480
IRSTNPEIVL IAEQEAANND PRWETRFASS LQYYSAVFDM VDSCLPLESP ARVKVEEMLA  540
REIRNIVSGD GGERVERHEV FGEWRKMMEE RGFRCAGIGE RERLLSQMLL RMFACKSYGL  600
ENQGEEEHGG GGLTLRWLDQ PLYTVSAWAP CETAAAPSSR SPPG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-6726563026380Protein SCARECROW
5b3h_A2e-6726563025379Protein SCARECROW
5b3h_D2e-6726563025379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008800814.10.0protein DWARF AND LOW-TILLERING
SwissprotQ9CAN31e-171SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A1D1XIS60.0A0A1D1XIS6_9ARAE; Scarecrow-like protein 28
STRINGXP_008800814.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64043455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-165GRAS family protein