PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0015100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 184aa    MW: 20354.2 Da    PI: 11.5013
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0015100genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.6e-18107141135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C +C + +Tp+WR gp+g+ktLCnaCG+++++ +l
  Spipo1G0015100 107 CWHCAAEETPQWRAGPEGPKTLCNACGVRFKSGRL 141
                     99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.0E-14101151IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.82101137IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.8E-15101138IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.42E-14103164No hitNo description
CDDcd002021.11E-12106154No hitNo description
PROSITE patternPS003440107132IPR000679Zinc finger, GATA-type
PfamPF003208.1E-16107141IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MVSSQAFVEE DLEWLSNKDA FPSLDTFLSV PNRPSPPAPA LAGAKRPSPV SVLDGAPPPP  60
PPLVLQWAAG RARSRGRRRR RRDLRAFRGR SPEEAAPSRA PREKRRCWHC AAEETPQWRA  120
GPEGPKTLCN ACGVRFKSGR LVPEYRPASS PTFSSDLHSN SHRKIMEMRR RNLEELGTAA  180
KKG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17080RARSRGRRRRR
27281RSRGRRRRRR
37481RGRRRRRR
47684RRRRRRDLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009365481.11e-49PREDICTED: GATA transcription factor 1
RefseqXP_009365480.11e-49PREDICTED: GATA transcription factor 1
RefseqXP_009365479.11e-49PREDICTED: GATA transcription factor 1
RefseqXP_007034503.12e-49GATA transcription factor 1, putative
SwissprotP697812e-38GAT12_ARATH; GATA transcription factor 12
TrEMBLA0A061ESZ52e-49A0A061ESZ5_THECC; GATA transcription factor 1, putative
STRINGBra001925.1-P3e-46(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.16e-38GATA transcription factor 1