PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo19G0011900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 162aa    MW: 17782.6 Da    PI: 9.0561
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo19G0011900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.14.2e-45141131100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++C++apyfp e+p+kf nvhk+FGasnv+kll++l +++reda++sl+yeAear++dPvyG+vg i+ lq+q+++l++el
  Spipo19G0011900  14 PCAACKFLRRKCTPSCIFAPYFPPEEPQKFSNVHKIFGASNVTKLLNDLLPHQREDAVNSLAYEAEARIKDPVYGCVGAISVLQRQVQRLQKEL 107
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++++e
  Spipo19G0011900 108 DAANAE 113
                      999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.02213114IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4414111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MQRGMASSNT SYSPCAACKF LRRKCTPSCI FAPYFPPEEP QKFSNVHKIF GASNVTKLLN  60
DLLPHQREDA VNSLAYEAEA RIKDPVYGCV GAISVLQRQV QRLQKELDAA NAELLRYACN  120
DIPTGMPVGP LVARLSPDTL RILPLAGLHH ARAEAKHIKV Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-701312810128LOB family transfactor Ramosa2.1
5ly0_B3e-701312810128LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021292136.13e-79protein LATERAL ORGAN BOUNDARIES
RefseqXP_021292137.13e-79protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML46e-69LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A2U1Q2L92e-77A0A2U1Q2L9_ARTAN; LOB domain-containing protein
STRINGEOY208516e-78(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-71LBD family protein
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]