PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo18G0031200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family G2-like
Protein Properties Length: 305aa    MW: 33969.8 Da    PI: 5.1782
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo18G0031200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.79.2e-27208258151
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      k+r++W++eLH+rF++a++qLGG+e+AtPk+i+e+m+ +gLt+++vkSHLQ
  Spipo18G0031200 208 KTRRCWSQELHRRFLDALNQLGGTEVATPKRIREIMQEDGLTNDEVKSHLQ 258
                      68************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.015205265IPR017930Myb domain
SuperFamilySSF466897.53E-13205258IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.0E-22206258IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-22208258IPR006447Myb domain, plants
PfamPF002493.0E-6210258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MDLASIFSKA EGKGRSYEDY LEALEEERKK IQVFHRELPL SLHLVTYAIE SCRRQVAAEL  60
FPPRVDFRSE HEDEELISDG APALEEFIPM KLNSSTPEAD DEESGDTAVR KRDWLKSVQL  120
WTPHPSEEDN RGPWIPVSEK ESKSTATLLT FLSQKRPLQE PAVLSVETQR IPDATPPPQT  180
ASSTSETRGA RGSSSSGGDE KRPQTHRKTR RCWSQELHRR FLDALNQLGG TEVATPKRIR  240
EIMQEDGLTN DEVKSHLQGN SGNAQQQQVV FVGGIWVPPS EYTTTIAATA TVRRPMAEQA  300
AAAP*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate homeostasis. Involved in the regulation of the developmental response of lateral roots, acquisition and/or mobilization of phosphate and expression of a subset of genes involved in phosphate sensing and signaling pathway. Is a target of the transcription factor PHR1. {ECO:0000269|PubMed:27016098}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced under phosphate deprivation conditions. {ECO:0000269|PubMed:27016098}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-64PREDICTED: myb family transcription factor EFM
SwissprotQ8VZS32e-55HHO2_ARATH; Transcription factor HHO2
TrEMBLA0A1D1XFE13e-65A0A1D1XFE1_9ARAE; Two-component response regulator ARR1
STRINGVIT_01s0011g03110.t014e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97733338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.18e-55G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]
  2. Sun X, et al.
    The GARP/MYB-related grape transcription factor AQUILO improves cold tolerance and promotes the accumulation of raffinose family oligosaccharides.
    J. Exp. Bot., 2018. 69(7): p. 1749-1764
    [PMID:29385617]