PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo15G0046500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRF
Protein Properties Length: 327aa    MW: 36351.9 Da    PI: 8.4874
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo15G0046500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.9e-2581124144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e
  Spipo15G0046500  81 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVE 124
                      79***************************************997 PP

2QLQ62.41.2e-211045237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTa+Q+q+L++Q+l++Ky+a+++PvP++Ll+++++
  Spipo15G0046500 10 PFTASQWQELEHQALIFKYMASGAPVPHDLLLPLRR 45
                     9********************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-11945IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.1E-161043IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.3821045IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.59681125IPR014977WRC domain
PfamPF088791.1E-2082124IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMSGRSSRYP FTASQWQELE HQALIFKYMA SGAPVPHDLL LPLRRSFFLD SAPPSPAQFF  60
PHQSGVGWGC FQMGLGRKVE DPEPGRCRRT DGKKWRCSKE AYPDSKYCER HMHRGKNRSR  120
KPVEISVPPI AATAAVAAPP TPSSLYPPHL SAGEAHHFLY PFAGPRHPHG GAPVDRDYRY  180
CHGMVKGDEG HHPYGFLSEA AGGERGGPWR FTPLGMSSLG DPRQRSCSSL GGGGFFAGPD  240
LPKEEEKRQH CFLLGADLKV ERRGKEEDDR AAEQQRPLRR FFDDWAPPKE KDEQHGWGGG  300
FPMTQLSISI PMAHHDFPVS NSRGDD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010932423.21e-114growth-regulating factor 1
TrEMBLA0A2H3XPD21e-103A0A2H3XPD2_PHODC; growth-regulating factor 1-like
STRINGONIVA02G36590.11e-83(Oryza nivara)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-49growth-regulating factor 5