PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo14G0039900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 931aa    MW: 105067 Da    PI: 9.0826
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo14G0039900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-15462508148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r+ WT++Ed +l  av+ +G ++W ++a+ m  gRt+ qc +rw+k l
  Spipo14G0039900 462 RKDWTEDEDSQLRAAVETFGEDNWQLVASNME-GRTGPQCSNRWRKTL 508
                      788*****************************.************975 PP

2Myb_DNA-binding51.52.3e-16516560247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      grW+ +Ed++l+ av ++G ++W++Ia+ ++ gRt  qc++rw + 
  Spipo14G0039900 516 GRWSVDEDKRLKVAVILFGAKNWNKIAQFIP-GRTQVQCRERWVNC 560
                      8******************************.***********986 PP

3Myb_DNA-binding40.85.2e-13569605341
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqck 41 
                       WT+eEd +l+da++++G   W+++a+ ++  Rt++qc+
  Spipo14G0039900 569 EWTEEEDTKLKDAIAKYGYC-WSKVASSVP-PRTDNQCR 605
                      6*****************99.*********.9******9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.11309403IPR017877Myb-like domain
SMARTSM007170.018313405IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-11315332IPR009057Homeodomain-like
CDDcd001670.00155364402No hitNo description
Gene3DG3DSA:1.10.10.601.2E-11375415IPR009057Homeodomain-like
SuperFamilySSF466893.74E-12385439IPR009057Homeodomain-like
PROSITE profilePS500908.548404456IPR017877Myb-like domain
SMARTSM007172.8E-4408458IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-12416465IPR009057Homeodomain-like
SuperFamilySSF466895.04E-19441512IPR009057Homeodomain-like
PROSITE profilePS5129414.848457508IPR017930Myb domain
SMARTSM007175.7E-15461510IPR001005SANT/Myb domain
PfamPF002491.5E-13462507IPR001005SANT/Myb domain
CDDcd001671.76E-12465508No hitNo description
Gene3DG3DSA:1.10.10.603.2E-16466511IPR009057Homeodomain-like
PROSITE profilePS5129421.697509565IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.9E-18512563IPR009057Homeodomain-like
SuperFamilySSF466899.16E-27512605IPR009057Homeodomain-like
SMARTSM007171.4E-14514563IPR001005SANT/Myb domain
PfamPF002495.9E-15516560IPR001005SANT/Myb domain
CDDcd001671.33E-12517559No hitNo description
Gene3DG3DSA:1.10.10.601.0E-15564606IPR009057Homeodomain-like
SMARTSM007172.3E-8566614IPR001005SANT/Myb domain
PROSITE profilePS5129412.435568630IPR017930Myb domain
PfamPF002491.1E-11569605IPR001005SANT/Myb domain
CDDcd001676.43E-11569606No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 931 aa     Download sequence    Send to blast
MVPSPYPRED DDGGDGESSS ASEWDDALDE DMEALRRACE ITGRRPADID GYSGGEGSDS  60
EDDLDLLRSI QERFPLPSTS EGPPILKPLN AIPSMDSEEE DDFETLRAIQ RRFVQYENDS  120
MKERNDGISF QALQVAPSAI SEKESSNQLL ESGNDESLSQ GYNDSAVLKP CGPTSLQQSE  180
DRSGHSSGRI SMYSRFPDCA QTFVDALKSN RSCQRFIRAK LIEIEAKIER NKELKRRAKC  240
LMDFQVVSGK RMNQALCQKR DPRVRLISLP KQRHSFSLKE SARKTLPLHY GPPENPHVSV  300
YRMVLSRCPV SLREQPWLKT EKENLAKGVK QQYQERMLLT TMDLSSDLAG SLGDSAAILR  360
KNFEFSPEDI RTFLPMVNWE RLASMYLPGR SGGECEARWL NYEDPSINHK PWTTHEEKKL  420
LHIVQTRGIY NWIDIAISLA THRTPFQCLV RYQRSLNPCI LRKDWTEDED SQLRAAVETF  480
GEDNWQLVAS NMEGRTGPQC SNRWRKTLHP SRRKVGRWSV DEDKRLKVAV ILFGAKNWNK  540
IAQFIPGRTQ VQCRERWVNC LDPSLNLEEW TEEEDTKLKD AIAKYGYCWS KVASSVPPRT  600
DNQCRRTPCI MIYSGFRVYR RWKVLFPDEV PLRQAAWKMQ KAVLVSNFVD RESERPLISP  660
SDFCISSSAD LHAITDGTKR RRRRSKTENP TSSSPSNASK CVSSQRPKAK DGISNETTSG  720
GKPAGHLKPK TVSKKRKKGM GKQNDKSDRV TEPEDINGRH IMSSCDTSQS GDAAGTSLEL  780
ASASFDAPQI SSFIRQNADG LSLPPSNAPK RVSSRRCKAK VGIPKETANG GNLAGHPGPK  840
TVSKNRRKGL GNFIPRFLGY FFWLLNFSSE KNSKALMNME VFHGMVRFFL IVDSGQCWRR  900
LGYGITNYRT INGQALGDCA SVLKPVWDGM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-293786058159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-293786058159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1678683KRRRRR
2728736PKTVSKKRK
3733737KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793540.10.0PREDICTED: uncharacterized protein LOC103709816 isoform X1
RefseqXP_008809746.10.0PREDICTED: myb-like protein L
TrEMBLA0A022RKE90.0A0A022RKE9_ERYGU; Uncharacterized protein (Fragment)
TrEMBLW9RFI80.0W9RFI8_9R
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-168myb domain protein 4r1