PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo13G0016500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 233aa    MW: 24487.9 Da    PI: 8.5854
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo13G0016500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.62.5e-44301291100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC++dCv+apyfp +qp+kfa vhk+FGasnv+kll++l + +reda++sl+yeAe+r+rdPvyG+vgvi+ lq+ql+ql+ +l
  Spipo13G0016500  30 PCAACKFLRRKCQPDCVFAPYFPPDQPQKFAHVHKVFGASNVTKLLNELTPYQREDAVNSLAYEAEMRLRDPVYGCVGVISILQHQLRQLQMDL 123
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      + +k+e
  Spipo13G0016500 124 SCAKSE 129
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.98429130IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4430127IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009799Biological Processspecification of symmetry
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009954Biological Processproximal/distal pattern formation
GO:0048441Biological Processpetal development
GO:0005654Cellular Componentnucleoplasm
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MMAPSSAMAL TTAAAAAAAA AATPSSTSSP CAACKFLRRK CQPDCVFAPY FPPDQPQKFA  60
HVHKVFGASN VTKLLNELTP YQREDAVNSL AYEAEMRLRD PVYGCVGVIS ILQHQLRQLQ  120
MDLSCAKSEL SKYQASATSA LVNVNVNKPV GFRGIAVGRE PFFAVPAGRD HHHLLMRSYD  180
ADMAGGVGSN VGYDAGFMAA AMNMSAGLGP LGGQFSKTRT AGGDERQAIG PS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-56201331114LOB family transfactor Ramosa2.1
5ly0_B2e-56201331114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00211DAPTransfer from AT1G65620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927922.12e-97LOB domain-containing protein 6
SwissprotA2WXT02e-74LBD6_ORYSI; LOB domain-containing protein 6
SwissprotQ8LQH42e-74LBD6_ORYSJ; LOB domain-containing protein 6
TrEMBLA0A1D1YBI81e-100A0A1D1YBI8_9ARAE; LOB domain-containing protein 6
STRINGXP_008807271.11e-92(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22673895
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.48e-62LBD family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]