PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo13G0014300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family bZIP
Protein Properties Length: 398aa    MW: 43189.3 Da    PI: 7.5402
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo13G0014300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.69.7e-12208266563
                      CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+   ++l+se+
  Spipo13G0014300 208 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATTLSAQLTMLQRDTSSLTSEN 266
                      9*******************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-16204268IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.151206269IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-11208264No hitNo description
PfamPF001705.3E-10208266IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.69E-11208263No hitNo description
CDDcd147039.96E-24209258No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MEKEAGLPPS SGHAPFGGSR SGSGFPVKPE RRSPSLPTPP AAPPEQGLLG RQFSGPFSRD  60
ISGMPDLPPR SLGHRRAQSE ILTLPDDISF DSDLGVVGSG DGPAMSDDAD EDFFLMYMDM  120
EKISSSAETS GALVLPGEPA AGPPPGENSP SSALTDRPRF RHQHSQSMDG SSIKSELLSS  180
AMEEASSAEA KKAMSAANLA DLALVDPKRA KRIWANRQSA ARSKERKMRY IAELERKVQT  240
LQTEATTLSA QLTMLQRDTS SLTSENSELK LRLQTMEQQV HLQDALNDTL REEVQRLKLV  300
TGQAGTANGA QMMNYGPSSS SFGAGGPPQP QYPNSHAMQS MLAAHQLQQL QIHPQHHQLQ  360
PRPNLHHPQQ QQQQQQVRGL HRISPRRSGR KIELTTN*
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867590.11e-137probable transcription factor PosF21
RefseqXP_015867591.11e-137probable transcription factor PosF21
RefseqXP_015867592.11e-137probable transcription factor PosF21
SwissprotQ040881e-116POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A3S3P9Y81e-138A0A3S3P9Y8_9MAGN; Putative transcription factor PosF21 isoform X1
STRINGXP_010268265.11e-136(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-96bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]