PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0061900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family G2-like
Protein Properties Length: 315aa    MW: 33918.8 Da    PI: 7.0442
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0061900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.92.7e-3498152155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr+rWtpeLHerFveav+qLGGsekAtPk +l+lm v+gLt++hvkSHLQkYR+
  Spipo11G0061900  98 KPRIRWTPELHERFVEAVSQLGGSEKATPKGVLKLMRVDGLTIYHVKSHLQKYRT 152
                      79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.59895155IPR017930Myb domain
SuperFamilySSF466891.54E-1896152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.6E-3297153IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2598152IPR006447Myb domain, plants
PfamPF002498.7E-10102151IPR001005SANT/Myb domain
PfamPF143791.9E-22185230IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGQIQSHAMV GSASRARQND WPDWVSSDSL GGSWNDYVLR TDAPLAESKA LYPAASHLLV  60
QMTAPPQPQF YQQMPSNSGG VSAANGSLSS GSSGPPTKPR IRWTPELHER FVEAVSQLGG  120
SEKATPKGVL KLMRVDGLTI YHVKSHLQKY RTARFRPDSS EGAPETNLAP LEGLSSVDQG  180
TGLGITEALR LQMEVQKKLH EQLEVQRKLQ LQIEEQGKYL QIIFETQRKM ENGGHNPRST  240
LDSTASATAA TNETPGRVGA AAADPEPAGE SSAGAGAEQR RVNPESPHEL DSVPSEAWPS  300
PPRGKRPRQG DVHP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2998156260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262509.12e-82PREDICTED: protein PHOSPHATE STARVATION RESPONSE 1-like
TrEMBLA0A1D1YDK33e-89A0A1D1YDK3_9ARAE; Myb family transcription factor APL
STRINGXP_010262509.19e-82(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.12e-65phosphate starvation response 1