PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0059500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 110aa    MW: 11729.3 Da    PI: 7.9613
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0059500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.21.1e-182659134
             GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                     C+ Cg++++p+WR+gp g+ktLCnaCG++y+k +
  Spipo11G0059500 26 CTDCGASQSPMWRKGPAGPKTLCNACGIRYAKAK 59
                     ******************************9976 PP

2HLH13.50.0001359801030
                     HHHHHHHHHHHHHHHCTSCC.C CS
              HLH 10 rrRRdriNsafeeLrellPk.a 30
                     +rRR ++ + +++Lre + + a
  Spipo11G0059500 59 KRRRTHLEELLQKLRETVLTpA 80
                     9******************954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.42055IPR000679Zinc finger, GATA-type
SMARTSM004012.8E-122071IPR000679Zinc finger, GATA-type
SuperFamilySSF577169.98E-142363No hitNo description
CDDcd002023.18E-122662No hitNo description
PfamPF003202.8E-162659IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.0E-162662IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS0034402651IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MAREDQSAPP PGKSDEGENT GAAVGCTDCG ASQSPMWRKG PAGPKTLCNA CGIRYAKAKR  60
RRTHLEELLQ KLRETVLTPA PHSGEEDVEA ALILMAFSSE HLLNASQKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15863KRRRTH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9FJ104e-15GAT16_ARATH; GATA transcription factor 16
STRINGCADAFLAP000111609e-14(Aspergillus flavus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24183892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.12e-16GATA transcription factor 16