PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0059200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 284aa    MW: 30983.1 Da    PI: 11.1145
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0059200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA53.92.5e-17183217135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +Cg+ +Tp+WR gp g+ktLCnaCG++y++ +l
  Spipo11G0059200 183 CWHCGAGETPQWRAGPHGPKTLCNACGVRYKSGRL 217
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.543177213IPR000679Zinc finger, GATA-type
SMARTSM004014.8E-15177227IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.61E-15178240No hitNo description
Gene3DG3DSA:3.30.50.101.1E-14181215IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.67E-14182230No hitNo description
PfamPF003201.8E-15183217IPR000679Zinc finger, GATA-type
PROSITE patternPS003440183208IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEPLDVSWMD ELLRDFTGDV ILPAPRSSSS RRHHRCGAGA GAAPPSQEEH RRQSSPAWSA  60
PIVHPSLLDG PATDPSPGFV EEEELEWLSN KEAFPTLETF DVYAYRKPSA PAPAPPPVQP  120
AAEAGSKRPS PVSVLAKGFL PAASPFLQRT PRRARSQGQQ RRRRVLPVFP SSRSSPGEEE  180
RRCWHCGAGE TPQWRAGPHG PKTLCNACGV RYKSGRLVPE YRPASSPTFS SALHSNSHRK  240
IMEMRRRKDS QGPSAATAGG AAGPTTANRK KKKKRKRKGL RLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1267274NRKKKKKR
2269277KKKKKRKRK
3270275KKKKRK
4271277KKKRKRK
5272277KKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008368588.12e-47PREDICTED: GATA transcription factor 1-like
TrEMBLA0A0R0I1E44e-46A0A0R0I1E4_SOYBN; Uncharacterized protein
TrEMBLI1LAK43e-46I1LAK4_SOYBN; Uncharacterized protein
STRINGGLYMA10G25480.18e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-35GATA transcription factor 1