PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo11G0034200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 312aa    MW: 33031.6 Da    PI: 6.6565
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo11G0034200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA565.4e-18217251135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  Spipo11G0034200 217 CTHCSSEKTPQWRTGPLGPKTLCNACGVRFKSGRL 251
                      *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169926.4E-7913302IPR016679Transcription factor, GATA, plant
SMARTSM004018.7E-17211261IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.42E-14215275No hitNo description
PROSITE profilePS5011411.253215247IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-13215249IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.35E-14216263No hitNo description
PROSITE patternPS003440217242IPR000679Zinc finger, GATA-type
PfamPF003209.1E-16217251IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGKMPIMGME AAGSSFSAAY VCGLPSSDAM RIDDLLDFSE QDDLFDAAAA LPESIQSHIL  60
PLHETSSTAG YLDSSAPQMC TFSDNLYIPS EEAAELEWLS KFVDDSFSDI PFPSCQGWSG  120
GNPVPSSNSS AVGSDPSAVP SRARSKRSKA PAAALQLASS TAWSSPQQSS SSATSSSSSS  180
SSSEFPPGVA SSNPKAPSTS SGRKKETRGE DGGVRRCTHC SSEKTPQWRT GPLGPKTLCN  240
ACGVRFKSGR LVPEYRPAAS PTFVLTQHSN SHRKVMELRR QKDVLRQQGS SATAVATSPR  300
PELLYRDYEV C*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008796101.12e-81PREDICTED: GATA transcription factor 4-like
SwissprotO497411e-63GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A059PZL43e-78A0A059PZL4_9POAL; GATA transcription factor
STRINGSb01g029170.12e-74(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.12e-49GATA transcription factor 2