PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0126300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 243aa    MW: 26940.5 Da    PI: 8.2054
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0126300genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.22.4e-403192263
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                    +e+al+cprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Spipo0G0126300 31 PEQALRCPRCDSTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGTLRNVPVGGGCRKNKRSSS 92
                    7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-273289IPR003851Zinc finger, Dof-type
PfamPF027011.0E-333389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.463589IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MGSHLLEEVF GCTNPSPPPS QQPDRRPRPQ PEQALRCPRC DSTNTKFCYY NNYSLSQPRY  60
FCKGCRRYWT KGGTLRNVPV GGGCRKNKRS SSKKIQDQAL LQTLPPPPPP PLTFDHNELS  120
LAFARLQKPL PTGQLGLDDH RHDSFMPPQA PGFLDDSLSS FSSLYYGLDG QGLLPFEMLS  180
GATAAIKQEP SYRCVEGDTS RLLMGLHWPV AVDGDVTVEA GREYWNGLGS TWQHGLVNSF  240
LI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922502.14e-73dof zinc finger protein DOF2.1
TrEMBLA0A1D1YVB28e-90A0A1D1YVB2_9ARAE; Dof zinc finger protein DOF2.1
STRINGXP_008802348.14e-72(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-40TARGET OF MONOPTEROS 6