PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0041900
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family LBD
Protein Properties Length: 168aa    MW: 18520.1 Da    PI: 7.3499
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0041900genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26054.92.6e-175210646100
          DUF260  46 lkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                      k+l e++r+da+ss+vyeA+ar+rdPvyG+v+ i++lq+q+e l+a+la +++e
  Spipo0G0041900  52 HKELAEHHRSDAVSSMVYEANARLRDPVYGCVAAISTLQHQVEVLQAQLAIAQAE 106
                     468899********************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.6E-1553104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAARRRQPLF REKLITHLLK LGKDGRERER ERERETVQPL PEHTDSPREL LHKELAEHHR  60
SDAVSSMVYE ANARLRDPVY GCVAAISTLQ HQVEVLQAQL AIAQAEMVRL RLWHKIFLAA  120
TGETVGSTSA GGAGAAATSP GSKPIFSGDA MMDQALAMDE PLWAHHS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-155110955113LOB family transfactor Ramosa2.1
5ly0_B1e-155110955113LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008787332.16e-32LOB domain-containing protein 4
TrEMBLA0A2H3XQP21e-30A0A2H3XQP2_PHODC; LOB domain-containing protein 4
STRINGXP_008787332.12e-31(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16530.15e-26ASYMMETRIC LEAVES 2-like 9