PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g098370.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 303aa    MW: 33100.3 Da    PI: 6.7345
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g098370.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.63.3e-3452106155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQkYRl
  Sopim12g098370.0.1  52 RPRLRWTAELHERFVDAVSQLGGPDKATPKTIMKAMGVKGLTLYHLKSHLQKYRL 106
                         59****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.7E-3249107IPR009057Homeodomain-like
PROSITE profilePS5129413.3149109IPR017930Myb domain
SuperFamilySSF466892.33E-1751108IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-2453107IPR006447Myb domain, plants
PfamPF002491.1E-954105IPR001005SANT/Myb domain
PfamPF143792.3E-25150195IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MKMYSSLGID GNGGVNEYHH HHHHLPSLQS SLSGEMTNLA GDACLVLTAD HRPRLRWTAE  60
LHERFVDAVS QLGGPDKATP KTIMKAMGVK GLTLYHLKSH LQKYRLGKQS KEAAESYKDE  120
SCVAESQDTS PSASGSSKVV AQDINDCGYQ VTEAFRVQME VQRRLQEQLE VQRHVQLRIE  180
AQGKYLQTIL EKACKVLNYT SVESPDLDTA REQLSELAIK GATNNCDGIV PVSSLPEVVT  240
SFENKNASDM PASIGECLSS TTTTASPTSI SALKKRPRAL ANGDVLPVEN NMTQVQWMMT  300
SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1952108157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1952108157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1952108157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1952108157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252994.10.0protein PHR1-LIKE 3-like isoform X1
SwissprotQ8LAJ71e-100PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A3Q7JF250.0A0A3Q7JF25_SOLLC; Uncharacterized protein
STRINGSolyc12g098370.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-82G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]