PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim12g049320.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GRAS
Protein Properties Length: 268aa    MW: 29779.8 Da    PI: 5.8861
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim12g049320.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS48.22e-15159251294
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL  cA a+++g+l+++q+lL  l+el+s +gd+++Rlaa  ++AL   l+  +++  ++ ++ + +++n +   ++l  f+e+sP+++
  Sopim12g049320.0.1 159 EQLLNPCAAAITAGNLNRVQHLLYVLRELSSLNGDANHRLAARGLQALTYYLSTPCPTSLSSASAATFASTNPKFFKNSLINFNEISPWFR 249
                         689************************************************************9999999999999999999********9 PP

                GRAS  93 fs 94 
                         + 
  Sopim12g049320.0.1 250 IP 251
                         76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098510.847132267IPR005202Transcription factor GRAS
PfamPF035146.7E-13159251IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MTIDETTSDP ISEWLDSPLS YFPSLLDDES YSIDDLLDES YSLDDIYEDS WWAPNESINQ  60
EIHINNNNDN SLPCFDTSFP VTTASTVSLE PVISSHLPPL DSSKKRKGND SGYNPKASRK  120
NQNRRINDAD TRRTTGHKKA THKSSTGNNG NNREGRWAEQ LLNPCAAAIT AGNLNRVQHL  180
LYVLRELSSL NGDANHRLAA RGLQALTYYL STPCPTSLSS ASAATFASTN PKFFKNSLIN  240
FNEISPWFRI PNSIFLMVFN GQHCSRS*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755240.0HG975524.1 Solanum lycopersicum chromosome ch12, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004252517.20.0nodulation-signaling pathway 1 protein-like
TrEMBLA0A3Q7J9R10.0A0A3Q7J9R1_SOLLC; Uncharacterized protein
STRINGSolyc12g049320.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.17e-27GRAS family protein