PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g071810.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family YABBY
Protein Properties Length: 178aa    MW: 19906.6 Da    PI: 9.6948
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g071810.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY232.88.4e-72101714170
               YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast 94 
                           sse+vCy+qCnfCntilavsvP + ++++vtvrCGhC+++lsvn+    q+l+ ++   ++l+ ++  + +++++n+k + ++++s+s+
  Sopim11g071810.0.1  10 SPSSERVCYLQCNFCNTILAVSVPCSNMLTLVTVRCGHCANMLSVNIGSLIQALPLQDV--QKLQRQQYTNVENNSSNYKAYGSSSSSSSK 98 
                         5689****************************************************996..556666677777777777777666666665 PP

               YABBY  95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                          ++ ++    + +  p++ p irPPekrqrvPsaynrfikeeiqrikasnPdishreafs+aaknWahfP+ihfgl
  Sopim11g071810.0.1  99 FNRYSS--IVSPQIEPKI-PSIRPPEKRQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHFPHIHFGL 171
                         555533..3334444554.46*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.4E-7312171IPR006780YABBY protein
SuperFamilySSF470951.96E-8116164IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.103.0E-5119165IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MSFDMTFSSS PSSERVCYLQ CNFCNTILAV SVPCSNMLTL VTVRCGHCAN MLSVNIGSLI  60
QALPLQDVQK LQRQQYTNVE NNSSNYKAYG SSSSSSSKFN RYSSIVSPQI EPKIPSIRPP  120
EKRQRVPSAY NRFIKEEIQR IKASNPDISH REAFSTAAKN WAHFPHIHFG LKLEGNK*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5576740.0EU557674.1 Solanum lycopersicum FAS protein (fasciated) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234390.11e-130FAS protein
SwissprotQ9XFB05e-68YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLB2YHV81e-130B2YHV8_SOLLC; FAS protein
STRINGSolyc11g071810.1.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38124163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.13e-64YABBY family protein