PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g012750.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NF-YB
Protein Properties Length: 153aa    MW: 17609.1 Da    PI: 6.2306
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g012750.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB166.33.9e-5258151295
               NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 
                         reqdrf+Pianv+rim+++lP +akis+d+k+t+qecvsefisfvt+ea+++cq e+rkti+++d+lwa++ lGf+dy+epl+ yl++yre
  Sopim11g012750.0.1  58 REQDRFMPIANVIRIMRRILPPHAKISDDSKQTIQECVSEFISFVTGEANERCQCEQRKTITAEDVLWAMSRLGFDDYIEPLTFYLHRYRE 148
                         89***************************************************************************************** PP

               NF-YB  93 leg 95 
                         ++g
  Sopim11g012750.0.1 149 IDG 151
                         987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-4751149IPR009072Histone-fold
SuperFamilySSF471131.43E-3660149IPR009072Histone-fold
PfamPF008086.6E-2563127IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.7E-1691109No hitNo description
PROSITE patternPS00685094110IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.7E-16110128No hitNo description
PRINTSPR006152.7E-16129147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MANLAHIYTL LYFYRAKMDN NGGGFHGYHT FPSTPATEMR MGVPVPVHLN QDSECTIREQ  60
DRFMPIANVI RIMRRILPPH AKISDDSKQT IQECVSEFIS FVTGEANERC QCEQRKTITA  120
EDVLWAMSRL GFDDYIEPLT FYLHRYREID GA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-3856148193NF-YB
4awl_B1e-3856148294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3856148294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
GenBankAC2369480.0AC236948.1 Solanum lycopersicum cv. Heinz 1706, chromosome 5 BAC clone C05SLe0114E01, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250562.21e-113PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W665e-67NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK4D6791e-114K4D679_SOLLC; Uncharacterized protein
STRINGSolyc11g012750.1.11e-113(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.13e-68nuclear factor Y, subunit B6