PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim11g010940.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 376aa    MW: 40926.5 Da    PI: 7.0323
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim11g010940.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.2e-392989262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ke+al+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk++
  Sopim11g010940.0.1 29 KEQALNCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKMK 89
                        67999*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.1E-333187IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-263283IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4223387IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MMSQDNKGES QSSGGGDDGG GGPMGARPKE QALNCPRCDS PNTKFCYYNN YSLSQPRHFC  60
KTCRRYWTKG GALRNVPIGG GCRKNKKMKT SSSSTRFSGD SKDTISGSSD IGGLKFFHGL  120
SPAMDFQLGG LNFPRLSNNS STSTVGGNIF NQFSSFGENS TPNIGSTSCF SLDPSGSSSL  180
LGFNNNFPFS SSMLKQGNEG VQEMGSMGVH HGTMASSIES LSSINQDLHW KLQQQRLSML  240
FGGENQKENI ISSSIPLHDD QNQNQNQIQI QKPQPILFQN LEISSSKQQE DHQETFGNNN  300
VDSRKDCSTT IGNHHGNNLS TEWFFDNSFG LNSNSTHSNN NNNNGNGNAN DDQNVNNWNS  360
TIQAWSNLNQ YSTLP*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755230.0HG975523.1 Solanum lycopersicum chromosome ch11, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004250167.10.0dof zinc finger protein DOF5.7
TrEMBLA0A3Q7IS930.0A0A3Q7IS93_SOLLC; Uncharacterized protein
STRINGSolyc11g010940.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.13e-47Dof family protein