PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim10g008880.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family VOZ
Protein Properties Length: 478aa    MW: 53537.7 Da    PI: 6.3614
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim10g008880.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ413.92.9e-1271994181217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewl...qdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaataks 88 
                         pppsaflgpkcalwdc+rpa gs+w+   qdycs +ha+la neg pg  pv+rp gi+lkd+llf+al ak++gkevg+pecegaataks
  Sopim10g008880.0.1 199 PPPSAFLGPKCALWDCPRPAMGSDWCqksQDYCSDYHASLAPNEGYPGRPPVVRPMGIGLKDNLLFQALGAKAHGKEVGVPECEGAATAKS 289
                         89***********************944459************************************************************ PP

                 VOZ  89 pwnaaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeinelda 179
                         pwna+elfdl+++ege irewlffdkprrafesgnrkqrslpdy+grgwhesrkq+m+efgglkrsyymdpqp++++ewhlyeyein++da
  Sopim10g008880.0.1 290 PWNAPELFDLKVVEGEVIREWLFFDKPRRAFESGNRKQRSLPDYNGRGWHESRKQMMNEFGGLKRSYYMDPQPMKNLEWHLYEYEINKYDA 380
                         ******************************************************************************************* PP

                 VOZ 180 lalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                         +alyrlelklvd+kk +kgk+s+ s+adlqk++grlta
  Sopim10g008880.0.1 381 CALYRLELKLVDGKKIPKGKISNVSVADLQKQMGRLTA 418
                         ************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MRKVSKRGAC KSASHQLFKD RAKNRVDDLQ GVLTNLQSAR KESRTYDVGL LEEQVHQMLR  60
EWKSELNEPS PASSLQGGSR VSSSADIYRL LLGEEEDDAT SALAAPKPEP DAQKVSITGF  120
QEGFNVTQVL QEQGFQLVDQ CKGLPLMVNN TGVNNLGIAT QLDYHSFDLH REYDQQYLPG  180
FDALNLCLED AMPPIHISPP PSAFLGPKCA LWDCPRPAMG SDWCQKSQDY CSDYHASLAP  240
NEGYPGRPPV VRPMGIGLKD NLLFQALGAK AHGKEVGVPE CEGAATAKSP WNAPELFDLK  300
VVEGEVIREW LFFDKPRRAF ESGNRKQRSL PDYNGRGWHE SRKQMMNEFG GLKRSYYMDP  360
QPMKNLEWHL YEYEINKYDA CALYRLELKL VDGKKIPKGK ISNVSVADLQ KQMGRLTAEF  420
PLDNKRTVKG RVKANMKNMG NIHAAPVPIV PIGEGFDYGN TDPYDYLLDD LDGYFIT*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0145160.0BT014516.1 Lycopersicon esculentum clone 133906R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004248126.10.0transcription factor VOZ1
RefseqXP_004248127.10.0transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A3Q7J7010.0A0A3Q7J701_SOLLC; Uncharacterized protein
STRINGSolyc10g008880.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28182454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]